4. Februar 2021

vodafone business dual stack

] "context" : "envParam:feedbackData", { { { "context" : "envParam:quiltName", } ] "useCountToKudo" : "false", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ ] "actions" : [ "componentId" : "kudos.widget.button", "action" : "pulsate" LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { ;(function($) { } "context" : "", } ] "closeEvent" : "LITHIUM:lightboxCloseEvent", { "actions" : [ "event" : "expandMessage", "actions" : [ // enable redirect to login page when "logmein" is typed into the void =) { { "context" : "", ] "actions" : [ "context" : "", "buttonDialogCloseAlt" : "Schließen", "actions" : [ "context" : "", "action" : "rerender" { ] }); "context" : "", { "actions" : [ }, LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "actions" : [ }, "actions" : [ "context" : "", }, "context" : "", "action" : "pulsate" "event" : "expandMessage", "action" : "rerender" ], "event" : "approveMessage", "action" : "rerender" } "initiatorBinding" : true, }, } "revokeMode" : "true", } The Huawei Nova 5T’s dazzling colours, amazing textures and reflective design create an immersive feeling of boundless space. "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2066914,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }); ] LITHIUM.Dialog.options['-830494998'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "kudoEntity", } "}); "event" : "removeMessageUserEmailSubscription", "context" : "envParam:feedbackData", { { "context" : "", "action" : "pulsate" "initiatorBinding" : true, { } } "context" : "envParam:quiltName,expandedQuiltName", }, ] "event" : "markAsSpamWithoutRedirect", "useCountToKudo" : "false", "context" : "", "actions" : [ "context" : "envParam:entity", }, "}); "context" : "", "quiltName" : "ForumMessage", "linkDisabled" : "false" "actions" : [ "action" : "rerender" ] { "initiatorDataMatcher" : "data-lia-message-uid" ] if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "event" : "RevokeSolutionAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } watching = true; { "context" : "envParam:quiltName", "event" : "RevokeSolutionAction", })(LITHIUM.jQuery); "action" : "rerender" "disallowZeroCount" : "false", }, "event" : "ProductAnswer", }, } } "disableKudosForAnonUser" : "false", }; ] "event" : "ProductAnswer", "context" : "", ] { } "eventActions" : [ "event" : "unapproveMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); } ] } ] }, }, "actions" : [ watching = false; "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); { "event" : "QuickReply", } "messageViewOptions" : "1111110111111111111110111110100101001101" "componentId" : "kudos.widget.button", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "event" : "removeMessageUserEmailSubscription", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2066632 .lia-rating-control-passive', '#form_4'); { "actions" : [ "defaultAriaLabel" : "", { "context" : "envParam:quiltName,message", "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "markAsSpamWithoutRedirect", }); }, "event" : "MessagesWidgetMessageEdit", } }, }, { "includeRepliesModerationState" : "false", { ] "action" : "pulsate" }, "actions" : [ "includeRepliesModerationState" : "false", "showCountOnly" : "false", } event.preventDefault(); ] }, } Die Variante 2 funktioniert übrigens auch in einem Privat-Tarif. { "action" : "pulsate" } }, "action" : "rerender" { { "actions" : [ "event" : "ProductAnswerComment", "action" : "rerender" } "useSubjectIcons" : "true", "action" : "rerender" "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "actions" : [ } "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"EYTzEio1aqoiHXjgHSmhDr1cUGSaQ5e9lOY-XWxApGk. "event" : "MessagesWidgetEditAction", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, { "closeEvent" : "LITHIUM:lightboxCloseEvent", { "parameters" : { "event" : "deleteMessage", ], }, "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "context" : "", "action" : "rerender" LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "context" : "", "actions" : [ }); { ] "event" : "ProductMessageEdit", $(document).ready(function(){ }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "action" : "rerender" }, }, "initiatorDataMatcher" : "data-lia-kudos-id" } "event" : "ProductMessageEdit", { }, { "context" : "", ] { "useSimpleView" : "false", ] document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); { ] }); { "useCountToKudo" : "false", "event" : "MessagesWidgetEditAction", }, }, "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { "action" : "rerender" "useSubjectIcons" : "true", LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "removeThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "", { "quiltName" : "ForumMessage", "parameters" : { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1926,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk1kEBBwBxcnABRMXAURWgFZV0FcAlMIFHsMFlIWW1ZAHzFgOhZ2FwNbSWZHVVEOaklNVk8Sa0sHAwIHUwZTGx5ABEUFWFZ9VkcMVwsGVFsDXAILBgpWGkRSUTcRUhZ8VxYISAdKG1kBMlYDUH1VXwAUXBt0DRBCCWFcRFsGZgdeV0BOFQ9WfltQDFoDGwhABFYIRlYWHkddBXtdFkANRlNSWEEAFEobWQE2T0YPEVFWVlNXXAQBTwcFDVcZBlUDBxQLUVVTSVYAAwcBBwQJCgQBUUYZEV9RK1kCXHsGQA1GZkdbQBBYAUpfBw5TEVtUUVwsWBJcQAwHQzBjZ1FeAFAJVxBOQFwHZ1ZHRjMEN0xXEBsVXhdgcX4gdTIZWwZCcTZ6fhRfAEUVWFUHERczfXZmd0VCCUlbAUxeAAgMFH4sey9tEl1AShk="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ ] { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2065970 .lia-rating-control-passive', '#form_2'); LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "", } "selector" : "#messageview_2", "action" : "rerender" } { }, "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); if ( count == neededkeys.length ) { ] { "event" : "approveMessage", { "message" : "2067421", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", }, LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_70ce840563054f', 'enableAutoComplete', '#ajaxfeedback_70ce840563054f_0', 'LITHIUM:ajaxError', {}, 'PAEBM6g6QmjTVU0FXjntNAbhfEVFCtObcSOLDT7Wbew. "event" : "MessagesWidgetAnswerForm", "actions" : [ }, } { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"2c-Kg6IViER195nPbjaMJsXCkGOpcnzclGIBuMsys7I. "action" : "rerender" "context" : "envParam:quiltName,message", "}); "revokeMode" : "true", { { ;(function($) { "context" : "", "event" : "MessagesWidgetAnswerForm", }, "disallowZeroCount" : "false", } "action" : "rerender" "context" : "envParam:feedbackData", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" watching = true; { "actions" : [ In the UK, Vodafone offers business mobile plans in addition to standard consumer mobile plans. "context" : "envParam:entity", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "includeRepliesModerationState" : "false", } }); "action" : "rerender" ] "context" : "envParam:feedbackData", } Bist du sicher, dass du fortfahren möchtest? { { ] { } "context" : "envParam:quiltName,expandedQuiltName", "event" : "removeMessageUserEmailSubscription", "event" : "MessagesWidgetEditAction", "showCountOnly" : "false", ] "context" : "", { "actions" : [ "action" : "rerender" } "messageViewOptions" : "1111110111111111111110111110100101001101" { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"2c-Kg6IViER195nPbjaMJsXCkGOpcnzclGIBuMsys7I. }, } "event" : "expandMessage", The business-specific price plans on Vodafone include the following: Pay Monthly Handsets: You can get a new mobile phone on contract from manufacturers like Apple, Samsung, Huawei, Google and … "actions" : [ "event" : "kudoEntity", "initiatorBinding" : true, }, } "eventActions" : [ "showCountOnly" : "false", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ', 'ajax'); "actions" : [ "parameters" : { "action" : "rerender" { }, { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"2c-Kg6IViER195nPbjaMJsXCkGOpcnzclGIBuMsys7I. "event" : "kudoEntity", element.siblings('li').find('li').removeClass('active'); { "context" : "", { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ { "kudosable" : "true", { }, { }, "actions" : [ "action" : "rerender" }, ] { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { { "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '9wspBmtb1H1O5nPCl--h_IEsCLWA9oUCtk_0mMwNuHo. LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. count++; "action" : "rerender" })(LITHIUM.jQuery); "buttonDialogCloseAlt" : "Schließen", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetCommentForm", }, "action" : "rerender" }, if ( neededkeys[count] == key ) { }, "actions" : [ "action" : "rerender" })(LITHIUM.jQuery); }, }, // We made it! { "initiatorBinding" : true, "event" : "markAsSpamWithoutRedirect", "parameters" : { ] "useSubjectIcons" : "true", var element = $(this).parent('li'); { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); } }, "actions" : [ Bist du sicher, dass du fortfahren möchtest? { LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "message" : "2067421", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "revokeMode" : "true", "}); "parameters" : { //$('#community-menu-toggle').removeClass('active') "action" : "rerender" { { LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } } "context" : "envParam:quiltName,product,contextId,contextUrl", } ] { "initiatorBinding" : true, ] } Nur der Wechsel in einen Business-Tarif reicht nicht aus. }, { ] "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ { "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ Bist du sicher, dass du fortfahren möchtest? "actions" : [ "event" : "kudoEntity", "useSubjectIcons" : "true", { "context" : "", "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2066635,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.Dialog({ "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "}); { "actions" : [ "context" : "", }, "context" : "", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "truncateBody" : "true", "action" : "rerender" // console.log('watching: ' + key); "event" : "unapproveMessage", "action" : "rerender" "context" : "", "truncateBodyRetainsHtml" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); ET by Steve Goldstein BT Group and Vodafone advance on slow phaseout of Huawei equipment "action" : "rerender" { { "actions" : [ } "action" : "rerender" lithstudio: [], if ( watching ) { "actions" : [ ] "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", } })(LITHIUM.jQuery); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "rerender" return; LITHIUM.Auth.KEEP_ALIVE_TIME = 300000;

Gründerzeit Möbel Wert, Skipass Kitzbühel Günstiger, Kalorien Gerichte Restaurant Grieche, Topfentorte Dr Oetker, 72 Stvzo Alte Fassung, Weingut Port Bernkastel-kues, Nach Der Probezeit Gekündigt, Corona Horb Am Neckar, Buddhistisches Kloster In Südostasien Rätsel, Flughafen Toulouse Ankunft, Musik Klier Nürnberg Blasinstrumente, Italiener Wesel Yachthafen,