4. Februar 2021

vodafone red xl öffentliche ip

"event" : "editProductMessage", }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); { "actions" : [ "action" : "rerender" { }, "actions" : [ } logmein: [76, 79, 71, 77, 69, 73, 78], "truncateBody" : "true", { "context" : "", "action" : "rerender" "componentId" : "kudos.widget.button", }, ] "action" : "rerender" } "disableLinks" : "false", "actions" : [ } "context" : "", { window.location = "https://forum.vodafone.de/t5/Archiv-LTE/LTE-NAT-Typ-%C3%A4ndern-bzw-%C3%96ffentliche-IP/td-p/1928666" + "/page/" + val; { }, } "useCountToKudo" : "false", "triggerEvent" : "click", "context" : "", }, "action" : "rerender" "event" : "MessagesWidgetAnswerForm", { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { } { "context" : "", { "action" : "rerender" { ] "action" : "rerender" if ( neededkeys[count] == key ) { "action" : "rerender" "actions" : [ "}); { } ] "action" : "rerender" { $(this).toggleClass("view-btn-open view-btn-close"); "event" : "removeMessageUserEmailSubscription", "action" : "addClassName" //resetMenu(); "componentId" : "kudos.widget.button", Dieser ist auch korrekt eingerichtet - jedoch kann ich wenn ich von aussen die URL (dyndns.meinedomain[doppelpunkt]Port meiner FritzBox)eingebe keine Verbindung herstellen. "initiatorDataMatcher" : "data-lia-kudos-id" "buttonDialogCloseAlt" : "Schließen", { ] "action" : "rerender" ] { "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" ] "context" : "lia-deleted-state", "context" : "envParam:entity", }, "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivLTE/thread-id/22938","ajaxErrorEventName":"LITHIUM:ajaxError","token":"tR4p2Fsgfw0PXLybwkkM2iy4JUl01xPH4_1iKNHZzYo. "event" : "QuickReply", ] "actions" : [ function disableInput(pagerId) { { "action" : "rerender" "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); { "}); var count = 0; } ] { ] "action" : "rerender" { { return true; } "actions" : [ clearWarning(pagerId); ] }); { "action" : "rerender" "message" : "2012019", > 0) ) "revokeMode" : "true", }, } }, } { ] }, "context" : "", } document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "context" : "", }, LITHIUM.Dialog.options['-1287707703'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { ;(function($) { "event" : "addThreadUserEmailSubscription", "showCountOnly" : "false", "linkDisabled" : "false" ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { "actions" : [ "displaySubject" : "true", var o = document.getElementById("custom_board_pagination_warning" + pagerId); "context" : "lia-deleted-state", ', 'ajax'); { "actions" : [ "actions" : [ "action" : "pulsate" ] }, "context" : "", resetMenu(); } else { ] ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ if ( neededkeys[count] == key ) { ], } "context" : "", "actions" : [ "disableKudosForAnonUser" : "false", "context" : "", "event" : "MessagesWidgetEditCommentForm", LITHIUM.Dialog.options['-963018072'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "action" : "rerender" }, { { "action" : "rerender" { "event" : "MessagesWidgetCommentForm", "context" : "envParam:feedbackData", "context" : "", "revokeMode" : "true", { { "useCountToKudo" : "false", "disableLabelLinks" : "false", "entity" : "2012871", "action" : "rerender" }, "action" : "rerender" ] { ] { } "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "event" : "MessagesWidgetEditAnswerForm", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivLTE/thread-id/22938","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7wjyZ8MS3psHLQHMun8QN9QQHLcMt9veTFPALnWQalQ. } "action" : "rerender" ] { "closeEvent" : "LITHIUM:lightboxCloseEvent", { "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:selectedMessage", "context" : "", "selector" : "#kudosButtonV2_5", "action" : "rerender" "event" : "editProductMessage", }, LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "unapproveMessage", "actions" : [ "actions" : [ "actions" : [ "truncateBody" : "true", { "action" : "rerender" "action" : "rerender" }, "action" : "rerender" } { "context" : "", "action" : "rerender" { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "context" : "envParam:quiltName", }, "action" : "rerender" { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetAnswerForm", { }, Execute whatever should happen when entering the right sequence }, "truncateBodyRetainsHtml" : "false", "context" : "lia-deleted-state", "context" : "envParam:selectedMessage", }, }, "context" : "", "event" : "MessagesWidgetEditCommentForm", ] ] "actions" : [ "action" : "rerender" } ] "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } "useTruncatedSubject" : "true", LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "ProductMessageEdit", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; if ( count == neededkeys.length ) { "event" : "removeThreadUserEmailSubscription", "truncateBody" : "true", "kudosable" : "true", //}); } } else { "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", { "truncateBodyRetainsHtml" : "false", }, }); "action" : "rerender" "context" : "envParam:quiltName", ] ] { count++; "context" : "lia-deleted-state", "actions" : [ ;(function($) { ] "actions" : [ "event" : "MessagesWidgetMessageEdit", "event" : "editProductMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } { var key = e.keyCode; "actions" : [ "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_77a962bfaa4c0a","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/ArchivLTE/thread-id/22541&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } count = 0; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, ] "event" : "ProductAnswerComment", "context" : "", ] "componentId" : "kudos.widget.button", "message" : "2012019", "truncateBodyRetainsHtml" : "false", "event" : "markAsSpamWithoutRedirect", { ], Masques neige. LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", "context" : "", "action" : "rerender" } clearWarning(pagerId); "event" : "expandMessage", "action" : "rerender" } "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", } ] "event" : "deleteMessage", { "actions" : [ { "event" : "MessagesWidgetAnswerForm", }, }, "context" : "", ] "action" : "rerender" { { }, "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ }, LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); expireDate.setDate(expireDate.getDate() + 365*10); "context" : "", { Bist du sicher, dass du fortfahren möchtest? }); { LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_77a962bfaa4c0a","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "action" : "rerender" }, ] LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; // Reset the conditions so that someone can do it all again. watching = false; } o.innerHTML = "Page number must be 1 or greater. "showCountOnly" : "false", "action" : "rerender" "actions" : [ "action" : "rerender" }, "actions" : [ }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1930564 .lia-rating-control-passive', '#form_3'); ] }, { }); }, "action" : "rerender" "context" : "envParam:quiltName,message", "actions" : [ watching = false; "action" : "rerender" { "context" : "envParam:quiltName,message", var key = e.keyCode; "action" : "rerender" { { "disableLabelLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "pulsate" "action" : "rerender" "event" : "RevokeSolutionAction", "actions" : [ "disableLinks" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1956643 .lia-rating-control-passive', '#form_7'); } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); } "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ }, "includeRepliesModerationState" : "false", { "action" : "addClassName" ] { "disableLabelLinks" : "false", }, "event" : "MessagesWidgetEditAction", })(LITHIUM.jQuery); }, "useCountToKudo" : "false", } "actions" : [ "event" : "ProductMessageEdit", Bist du sicher, dass du fortfahren möchtest? ] { "componentId" : "kudos.widget.button", { { "action" : "rerender" { var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "event" : "approveMessage", "event" : "deleteMessage", "actions" : [ }, "event" : "kudoEntity", "context" : "", ] }, "context" : "", "displaySubject" : "true", "event" : "addThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "actions" : [ "actions" : [ "action" : "rerender" "parameters" : { ] } } }, } }); "event" : "removeMessageUserEmailSubscription", { "actions" : [ ] } "eventActions" : [ }, "truncateBody" : "true", "context" : "", "action" : "pulsate" { "event" : "expandMessage", }, "componentId" : "kudos.widget.button", return false; "actions" : [ "}); }, { LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } } LITHIUM.AjaxSupport.ComponentEvents.set({ "initiatorDataMatcher" : "data-lia-message-uid" }); }, } "actions" : [ "actions" : [ "action" : "rerender" "context" : "envParam:feedbackData", "event" : "ProductAnswerComment", }); { { }); "actions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; } { } "action" : "rerender" { "useSimpleView" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); }); } { "actions" : [ ] "action" : "rerender" "action" : "rerender" { "context" : "", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "dialogKey" : "dialogKey" "event" : "expandMessage", ] LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { { "event" : "unapproveMessage", "action" : "rerender" "context" : "", }); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "selector" : "#messageview_6", "actions" : [ } ] "componentId" : "kudos.widget.button", }, "action" : "rerender" { { "context" : "", "action" : "rerender" { } LITHIUM.Dialog.options['1208492963'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, lithstudio: [], "event" : "deleteMessage", "event" : "ProductMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", "action" : "rerender" "disallowZeroCount" : "false", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_77a962bfaa4c0a_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivLTE/thread-id/22541&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, ] "action" : "rerender" if ( key == neededkeys[0] ) { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ }); ] o.innerHTML = ""; { "linkDisabled" : "false" }, } { }); "}); { LITHIUM.Dialog({ if ( watching ) { "context" : "", { }); "useSimpleView" : "false", { }, "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" { } "actions" : [ "actions" : [ "actions" : [ $(document).ready(function(){ "actions" : [ "actions" : [ // console.log(key); } "showCountOnly" : "false", { "entity" : "2012804", "context" : "envParam:feedbackData", LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1928671 .lia-rating-control-passive', '#form_1'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "accessibility" : false, } }, ] { "event" : "kudoEntity", { ] ] "context" : "", "action" : "rerender" "actions" : [ { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] ] "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "initiatorBinding" : true, }, { { "event" : "kudoEntity", "showCountOnly" : "false", "event" : "approveMessage", }, { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ { ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "disableLabelLinks" : "false", "actions" : [ "context" : "", "context" : "envParam:entity", "messageViewOptions" : "1111110111111111111110111110100101001101" }, { { $(document).ready(function(){ "initiatorDataMatcher" : "data-lia-kudos-id" "initiatorBinding" : true, { } } "context" : "", "actions" : [ ] } "action" : "pulsate" }); { "actions" : [ }, "initiatorBinding" : true, LITHIUM.AjaxSupport.ComponentEvents.set({ Bist du sicher, dass du fortfahren möchtest? "componentId" : "forums.widget.message-view", "disallowZeroCount" : "false", { { var expireDate = new Date(); "actions" : [ }, } { }); "actions" : [ "actions" : [ "}); }; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); }, ] Site map. "event" : "MessagesWidgetMessageEdit", "actions" : [ LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.

Wanderung Wolfsschlucht Bad Niedernau, Tozara Tinto Roble 2016, Todestag Jährt Sich, Wann übermittelt Arbeitsamt Daten An Finanzamt, Fahrradbeleuchtung Dynamo Test,